Human TRAF5 protein

Artikelnummer: BYT-ORB246238
Artikelname: Human TRAF5 protein
Artikelnummer: BYT-ORB246238
Hersteller Artikelnummer: orb246238
Alternativnummer: BYT-ORB246238-20,BYT-ORB246238-100,BYT-ORB246238-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: TRAF5
This Human TRAF5 protein spans the amino acid sequence from region 1-557aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 80.4 kDa
UniProt: O00463
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-557aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRAF5.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRAF5.