Human THRB protein
Artikelnummer:
BYT-ORB246452
- Bilder (3)
| Artikelname: | Human THRB protein |
| Artikelnummer: | BYT-ORB246452 |
| Hersteller Artikelnummer: | orb246452 |
| Alternativnummer: | BYT-ORB246452-20,BYT-ORB246452-100,BYT-ORB246452-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | THRB ERBA2 NR1A2 THR1 |
| This Human THRB protein spans the amino acid sequence from region 1-461aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 68.8 kDa |
| UniProt: | P10828 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPI |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-461aa |



