E.coli entC3 protein
Artikelnummer:
BYT-ORB246518
- Bilder (3)
| Artikelname: | E.coli entC3 protein |
| Artikelnummer: | BYT-ORB246518 |
| Hersteller Artikelnummer: | orb246518 |
| Alternativnummer: | BYT-ORB246518-20,BYT-ORB246518-100,BYT-ORB246518-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | entC3 |
| This E.coli entC3 protein spans the amino acid sequence from region 28-266aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 43.6 kDa |
| UniProt: | P0A0L5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Staphylococcus aureus |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG |
| Anwendungsbeschreibung: | Biological Origin: Staphylococcus aureus. Application Notes: This is His-SUMO-tag protein |



