Yeast fbpB protein
Artikelnummer:
BYT-ORB246808
- Bilder (3)
| Artikelname: | Yeast fbpB protein |
| Artikelnummer: | BYT-ORB246808 |
| Hersteller Artikelnummer: | orb246808 |
| Alternativnummer: | BYT-ORB246808-20,BYT-ORB246808-100,BYT-ORB246808-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | fbpB |
| This Yeast fbpB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 32.7 kDa |
| UniProt: | P9WQP0 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFN |
| Anwendungsbeschreibung: | Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-tag protein |



