Human SMARCB1 protein

Artikelnummer: BYT-ORB246950
Artikelname: Human SMARCB1 protein
Artikelnummer: BYT-ORB246950
Hersteller Artikelnummer: orb246950
Alternativnummer: BYT-ORB246950-20,BYT-ORB246950-100,BYT-ORB246950-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: BRG1-associated factor 47 , BAF47Integrase interactor 1 protein, SNF5 homolog , hSNF5
This Human SMARCB1 protein spans the amino acid sequence from region 2-376aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 45 kDa
UniProt: Q12824
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILED
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial of His-tag and expression region is 2-376aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) SMARCB1.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) SMARCB1.