Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

Artikelnummer: BYT-ORB2657875
Artikelname: Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)
Artikelnummer: BYT-ORB2657875
Hersteller Artikelnummer: orb2657875
Alternativnummer: BYT-ORB2657875-1,BYT-ORB2657875-100,BYT-ORB2657875-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glucagon-like peptide 1 receptor, GLP-1 receptor, GLP-1-R, GLP-1R,Glp1r
This Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), patial spans the amino acid sequence from region 22-145aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 15.8 kDa
UniProt: O35659
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 µg/mL can bind Anti-GLP1R recombinant antibody. The EC50 is 141.7-172.4 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 µg/ml can bind Anti-GLP1R recombinant antibody. The EC50 is 141.7-172.4 ng/mL.