Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

Artikelnummer: BYT-ORB2658199
Artikelname: Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)
Artikelnummer: BYT-ORB2658199
Hersteller Artikelnummer: orb2658199
Alternativnummer: BYT-ORB2658199-1,BYT-ORB2658199-100,BYT-ORB2658199-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Parathyroid hormone/parathyroid hormone-related peptide receptor, PTH/PTHrP type I receptor, Parathyroid hormone 1 receptor, PTH1R
This Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial spans the amino acid sequence from region 29-188aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 20.0 kDa
UniProt: A0A2K5V724
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPANIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 µg/mL can bind Anti-PTH1R recombinant antibody. The EC50 is 1.072 to 1.403 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 µg/ml can bind Anti-PTH1R recombinant antibody. The EC50 is 1.072 to 1.403 ng/mL.