Recombinant Human Cell adhesion molecule CEACAM1 (CEACAM1), partial (Active)

Artikelnummer: BYT-ORB2658334
Artikelname: Recombinant Human Cell adhesion molecule CEACAM1 (CEACAM1), partial (Active)
Artikelnummer: BYT-ORB2658334
Hersteller Artikelnummer: orb2658334
Alternativnummer: BYT-ORB2658334-1,BYT-ORB2658334-100,BYT-ORB2658334-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cell adhesion molecule CEACAM1, Biliary glycoprotein 1, Carcinoembryonic antigen-related cell adhesion molecule 1, CD66a, CEACAM1, BGP
This Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1), partial spans the amino acid sequence from region 35-428aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 45.3 kDa
UniProt: P13688
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA.Immobilized Human CEACAM1 at 2 µg/mL can bind Anti-CEACAM1 recombinant antibody. The EC50 is 0.3677-0.4528 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA.Immobilized Human CEACAM1 at 2 µg/ml can bind Anti-CEACAM1 recombinant antibody. The EC50 is 0.3677-0.4528 ng/mL.