Recombinant Macaca mulatta Solute carrier family 10 member 1 (SLC10A1)-VLPs

Artikelnummer: BYT-ORB2658604
Artikelname: Recombinant Macaca mulatta Solute carrier family 10 member 1 (SLC10A1)-VLPs
Artikelnummer: BYT-ORB2658604
Hersteller Artikelnummer: orb2658604
Alternativnummer: BYT-ORB2658604-1,BYT-ORB2658604-100,BYT-ORB2658604-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Solute carrier family 10 member a1
This Recombinant Macaca mulatta Solute carrier family 10 member 1 (SLC10A1)-VLPs spans the amino acid sequence from region 1-349aa. Purity: The purity information is not available for VLPs proteins.
Molekulargewicht: 39.5 kDa
UniProt: F6YRK3
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MEAHNASAPFNFTLPPNFGKRPTDLALSIILVFMLFFVMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFQLNNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYLYTRGIYDGDLKDKVPYGRIILSLVPVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVS
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by SEC-HPLC



* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL