Recombinant Human Liver carboxylesterase 1 (CES1) (Active)

Artikelnummer: BYT-ORB2658694
Artikelname: Recombinant Human Liver carboxylesterase 1 (CES1) (Active)
Artikelnummer: BYT-ORB2658694
Hersteller Artikelnummer: orb2658694
Alternativnummer: BYT-ORB2658694-1,BYT-ORB2658694-100,BYT-ORB2658694-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Liver carboxylesterase 1, Acyl-coenzyme A:cholesterol acyltransferase (ACAT), Brain carboxylesterase hBr1, Carboxylesterase 1 (CE-1, hCE-1) (EC:3.1.1.13 ) , Cholesteryl ester hydrolase 1 publication (CEH 1 publication) (EC:3.1.1.134), Cocaine carboxylesterase,CES1 ,CES2, SES1
This Recombinant Human Liver carboxylesterase 1 (CES1) spans the amino acid sequence from region 18-567aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 62.0 kDa
UniProt: P23141
Puffer: Lyophilized from a 0.2 µm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
Formulierung: Lyophilized powder
Sequenz: GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its ability to hydrolyze p-nitrophenylacetate. The specific activity is >40000 pmol/min/µg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of CES1 was greater than 95% as determined by SEC-HPLC