Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial

Artikelnummer: BYT-ORB2658701
Artikelname: Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial
Artikelnummer: BYT-ORB2658701
Hersteller Artikelnummer: orb2658701
Alternativnummer: BYT-ORB2658701-1,BYT-ORB2658701-100,BYT-ORB2658701-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Atrial natriuretic peptide receptor 3, Atrial natriuretic peptide clearance receptor, Atrial natriuretic peptide receptor type C (ANP-C, ANPR-C, NPR-C)
This Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial spans the amino acid sequence from region 27-481aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 51.8 kDa
UniProt: P17342
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of NPR3 was greater than 95% as determined by SEC-HPLC