Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)

Artikelnummer: BYT-ORB2658706
Artikelname: Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)
Artikelnummer: BYT-ORB2658706
Hersteller Artikelnummer: orb2658706
Alternativnummer: BYT-ORB2658706-1,BYT-ORB2658706-100,BYT-ORB2658706-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: B-cell antigen receptor complex-associated protein alpha chain, Ig-alpha,MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD79a
This Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active) spans the amino acid sequence from region 33-143aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 14.0 kDa
UniProt: P11912
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 µg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 1.521-1.700 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CD79A at 2 µg/ml can bind Anti-CD79A recombinant antibody. The EC50 is 1.521-1.700 ng/mL.