Recombinant Macaca mulatta Cytokine receptor common subunit gamma (IL2RG), partial (Active)

Artikelnummer: BYT-ORB2658862
Artikelname: Recombinant Macaca mulatta Cytokine receptor common subunit gamma (IL2RG), partial (Active)
Artikelnummer: BYT-ORB2658862
Hersteller Artikelnummer: orb2658862
Alternativnummer: BYT-ORB2658862-1,BYT-ORB2658862-100,BYT-ORB2658862-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cytokine receptor common subunit gamma, Interleukin 2 receptor subunit gamma, Membrane receptor Il2rg
This Recombinant Macaca mulatta Cytokine receptor common subunit gamma (IL2RG), partial (Active) spans the amino acid sequence from region 23-255aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 28.8 kDa
UniProt: Q38JL2
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKENP
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 µg/mL can bind Anti-IL2RG recombinant antibody. The EC50 is 33.73-41.04 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 µg/ml can bind Anti-IL2RG recombinant antibody. The EC50 is 33.73-41.04 ng/mL.