Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial (Active)

Artikelnummer: BYT-ORB2659063
Artikelname: Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial (Active)
Artikelnummer: BYT-ORB2659063
Hersteller Artikelnummer: orb2659063
Alternativnummer: BYT-ORB2659063-1,BYT-ORB2659063-100,BYT-ORB2659063-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Parathyroid hormone/parathyroid hormone-related peptide receptor, PTH/PTHrP type I receptor (PTH/PTHr receptor), Parathyroid hormone 1 receptor (PTH1 receptor), Pth1r, Pthr, Pthr1
This Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial spans the amino acid sequence from region 27-188aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 20.0 kDa
UniProt: P25961
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLG
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Biological Activity: Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 µg/mL can bind Anti-PTH1R recombinant antibody. The EC50 is 0.7384-1.203 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 µg/ml can bind Anti-PTH1R recombinant antibody. The EC50 is 0.7384-1.203 ng/mL.