Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

Artikelnummer: BYT-ORB2659145
Artikelname: Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)
Artikelnummer: BYT-ORB2659145
Hersteller Artikelnummer: orb2659145
Alternativnummer: BYT-ORB2659145-1,BYT-ORB2659145-100,BYT-ORB2659145-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lymphocyte antigen 6E, Ly-6E,Retinoic acid-induced gene E protein (RIG-E), Stem cell antigen 2 (SCA-2), Thymic shared antigen 1 (TSA-1), LY6E, 9804, RIGE, SCA2, TSA1
This Recombinant Human Lymphocyte antigen 6E (LY6E) spans the amino acid sequence from region 21-101aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 34.6 kDa
UniProt: Q16553
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 µg/mL can bind Anti-LY6E recombinant antibody. The EC50 is 2.483-3.282 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 µg/ml can bind Anti-LY6E recombinant antibody. The EC50 is 2.483-3.282 ng/mL.