Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

Artikelnummer: BYT-ORB2659151
Artikelname: Recombinant Macaca mulatta Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)
Artikelnummer: BYT-ORB2659151
Hersteller Artikelnummer: orb2659151
Alternativnummer: BYT-ORB2659151-1,BYT-ORB2659151-100,BYT-ORB2659151-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: TNF superfamily member 15, Tumor necrosis factor ligand 1B
This Recombinant Macaca fascicularis TNF superfamily member 15(TNFSF15), partial, Biotinylated (Active) spans the amino acid sequence from region 72-251aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 25.3 kDa
UniProt: F6S8F9
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody at 2 µg/mL can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFSF15 recombinant antibody at 2 µg/ml can bind Biotinylated Macaca mulatta TNFSF15. The EC50 is 0.2589-0.3025 ng/mL.