Recombinant Human Folate receptor alpha (FOLR1), partial (Active)

Artikelnummer: BYT-ORB2659155
Artikelname: Recombinant Human Folate receptor alpha (FOLR1), partial (Active)
Artikelnummer: BYT-ORB2659155
Hersteller Artikelnummer: orb2659155
Alternativnummer: BYT-ORB2659155-1,BYT-ORB2659155-100,BYT-ORB2659155-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: FOLR
This Recombinant Human Folate receptor alpha(FOLR1), partial (Active) spans the amino acid sequence from region 25-233aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 25.9 kDa
UniProt: P15328
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human FOLR1 at 2 µg/mL can bind Anti-FOLR1 recombinant antibody. The EC50 is 6.893-7.883 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized human FOLR1 at 2 µg/ml can bind Anti-FOLR1 recombinant antibody. The EC50 is 6.893-7.883 ng/mL.