Recombinant Varicella-zoster virus Envelope glycoprotein B (gB), partial

Artikelnummer: BYT-ORB2659781
Artikelname: Recombinant Varicella-zoster virus Envelope glycoprotein B (gB), partial
Artikelnummer: BYT-ORB2659781
Hersteller Artikelnummer: orb2659781
Alternativnummer: BYT-ORB2659781-1,BYT-ORB2659781-100,BYT-ORB2659781-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: gB
This Recombinant Varicella-zoster virus Envelope glycoprotein B (gB), partial spans the amino acid sequence from region 176-274aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 37.5 kDa
UniProt: Q4JR05
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VSTAWAGSSYTQITNRYADRVPIPVSEITDTIDKFGKCSSKATYVRNNHKVEAFNEDKNPQDMPLIASKYNSVGSKAWHTTNDTYMVAGTPGTYRTGTS
Anwendungsbeschreibung: Biological Origin: Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of gB was greater than 90% as determined by SEC-HPLC