Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs

Artikelnummer: BYT-ORB2666633
Artikelname: Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs
Artikelnummer: BYT-ORB2666633
Hersteller Artikelnummer: orb2666633
Alternativnummer: BYT-ORB2666633-1,BYT-ORB2666633-100,BYT-ORB2666633-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Membrane-type receptor for bile acids,M-BAR
This Recombinant Mouse G-protein coupled bile acid receptor 1 (Gpbar1)-VLPs spans the amino acid sequence from region 1-329aa. Purity: The purity information is not available for VLPs proteins.
Molekulargewicht: 37.0 kDa
UniProt: Q80SS6
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Mus musculus (Mouse)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYVATLLLSVLAYERRPP
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 90% as determined by SEC-HPLC