Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)

Artikelnummer: BYT-ORB2666661
Artikelname: Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)
Artikelnummer: BYT-ORB2666661
Hersteller Artikelnummer: orb2666661
Alternativnummer: BYT-ORB2666661-1,BYT-ORB2666661-100,BYT-ORB2666661-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: B-cell-specific glycoprotein B29,Ig-beta,Immunoglobulin-associated B29 protein,CD antigen CD79b
This Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B),partial spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16.7 kDa
UniProt: P40259
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 µg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 3.214-3.642 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 µg/ml can bind Anti-CD79B recombinant antibody. The EC50 is 3.214-3.642 ng/mL.