Recombinant Human Interleukin-3 (IL3) (Active)

Artikelnummer: BYT-ORB2666680
Artikelname: Recombinant Human Interleukin-3 (IL3) (Active)
Artikelnummer: BYT-ORB2666680
Hersteller Artikelnummer: orb2666680
Alternativnummer: BYT-ORB2666680-1,BYT-ORB2666680-100,BYT-ORB2666680-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL-3,Hematopoietic growth factor,Mast cell growth factor,MCGF,Multipotential colony-stimulating factor,P-cell-stimulating factor
This Recombinant Human Interleukin-3 (IL3) spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 17.1 kDa
UniProt: P08700
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.