Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)

Artikelnummer: BYT-ORB2666706
Artikelname: Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)
Artikelnummer: BYT-ORB2666706
Hersteller Artikelnummer: orb2666706
Alternativnummer: BYT-ORB2666706-1,BYT-ORB2666706-100,BYT-ORB2666706-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Growth/differentiation factor 8, GDF-8, Myostatin, MSTN, GDF8
This Recombinant Human Growth/differentiation factor 8(MSTN) spans the amino acid sequence from region 24-375aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 42.2 kDa
UniProt: O14793
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MSTN(GDF-8) at 2 µg/mL can bind Human ACVR2B. The EC50 is 68.26-74.59 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human MSTN (GDF-8) at 2 µg/ml can bind Human ACVR2B. The EC50 is 68.26-74.59 ng/mL.