Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

Artikelnummer: BYT-ORB2666716
Artikelname: Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)
Artikelnummer: BYT-ORB2666716
Hersteller Artikelnummer: orb2666716
Alternativnummer: BYT-ORB2666716-1,BYT-ORB2666716-100,BYT-ORB2666716-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs spans the amino acid sequence from region 22-220aa. Purity: The purity information is not available for VLPs proteins.
Molekulargewicht: 22.6 kDa
UniProt: A0A0D9SBX5
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV
Anwendungsbeschreibung: Biological Origin: Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 µg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.186-6.635 ng/mL.The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 µg/ml can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.186-6.635 ng/mL.The VLPs is negative control.