Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)

Artikelnummer: BYT-ORB2992185
Artikelname: Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)
Artikelnummer: BYT-ORB2992185
Hersteller Artikelnummer: orb2992185
Alternativnummer: BYT-ORB2992185-1,BYT-ORB2992185-100,BYT-ORB2992185-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2 (TNF-a), Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF), Intracellular domain 1 (ICD1), Intracellular domain 2 (ICD2), C-domain 1, C-domain 2, Tumor necrosis factor, soluble form, Tnf, Tnfa, Tnfsf2
This Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active) spans the amino acid sequence from region 80-235aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 18.7 kDa
UniProt: P06804
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 26.52-46.24 pg/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.