Recombinant Human Zinc finger protein 395 (ZNF395)

Artikelnummer: BYT-ORB2992370
Artikelname: Recombinant Human Zinc finger protein 395 (ZNF395)
Artikelnummer: BYT-ORB2992370
Hersteller Artikelnummer: orb2992370
Alternativnummer: BYT-ORB2992370-1,BYT-ORB2992370-100,BYT-ORB2992370-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HD-regulating factor 2,Huntington disease gene regulatory region-binding protein 2,Papillomavirus regulatory factor 1,Papillomavirus-binding factor
This Recombinant Human Zinc finger protein 395 (ZNF395) spans the amino acid sequence from region 1-513aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 61.9 kDa
UniProt: Q9H8N7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.