BHLHB2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324508
| Artikelname: |
BHLHB2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324508 |
| Hersteller Artikelnummer: |
orb324508 |
| Alternativnummer: |
BYT-ORB324508-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti DEC1 antibody, anti SHARP-2 antibody, anti STRA13 antibody, anti Stra14 antibody, anti HLHB2 antibody, anti BHLHB2 antibody |
| Rabbit polyclonal antibody to BHLHE40 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
45 kDa |
| NCBI: |
003661 |
| UniProt: |
O14503 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE |
| Target-Kategorie: |
BHLHE40 |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. |
![]()
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Rabbit Anti-BHLHE40 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
![]()
|
WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T. |
