A630025C20RIK Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324711
| Artikelname: |
A630025C20RIK Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324711 |
| Hersteller Artikelnummer: |
orb324711 |
| Alternativnummer: |
BYT-ORB324711-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Mlr2 antibody, anti mKIAA1795 antibody, anti 3110023F06Rik antibody, anti A630025C20Rik antibody |
| Rabbit polyclonal antibody to Lcor |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
47 kDa |
| NCBI: |
742166 |
| UniProt: |
Q6ZPI3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK |
| Target-Kategorie: |
Lcor |
![]()
|
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
![]()
|
Sample Tissue: Mouse Liver, Antibody Dilution: 3 ug/mL. |
![]()
|
Sample Tissue: Mouse Lung, Antibody Dilution: 1 ug/mL. |
![]()
|
Sample Tissue: Mouse Thymus, Antibody Dilution: 3 ug/mL. |
![]()
|
WB Suggested Anti-A630025C20RIK Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate. |
