SLC41A1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325131
Artikelname: SLC41A1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325131
Hersteller Artikelnummer: orb325131
Alternativnummer: BYT-ORB325131-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A1
Konjugation: Unconjugated
Alternative Synonym: anti MgtE antibody
Rabbit polyclonal antibody to SLC41A1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 55kDa
NCBI: 776253
UniProt: Q8IVJ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP
Target-Kategorie: SLC41A1
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: MCF7 cell lysate, Antibody Dilution: 1.0 ug/mL.
Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/mL.
SLC41A1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325131 with 1:200 dilution. Western blot was performed using orb325131 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SLC41A1 IP with orb325131 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-SLC41A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.