TMEM30A Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325344
Artikelname: TMEM30A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325344
Hersteller Artikelnummer: orb325344
Alternativnummer: BYT-ORB325344-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TMEM30A
Konjugation: Unconjugated
Alternative Synonym: anti C6orf67 antibody, anti CDC50A antibody, anti FLJ10856 antibody
Rabbit polyclonal antibody to TMEM30A
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 41 kDa
NCBI: 060717
UniProt: Q9NV96
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
Target-Kategorie: TMEM30A
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Peptide present in canonical 41 kDa protein as well as a 37 kDa and 28 kDa isoforms.
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1 ug/mL.
Sample Type: 721_B, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Positive control (+): Stomach tumor (T-ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.
Rabbit Anti-TMEM30A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-TMEM30A Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate.