FKBP5 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB325933
Artikelname: FKBP5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB325933
Hersteller Artikelnummer: orb325933
Alternativnummer: BYT-ORB325933-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP5
Konjugation: Unconjugated
Alternative Synonym: anti FKBP51 antibody, anti FKBP54 antibody, anti MGC111006 antibody, anti P54 antibody, anti PPIase antibody, anti Ptg-10 antibody, anti AIG6 antibody
Rabbit polyclonal antibody to FKBP5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 51 kDa
NCBI: 004108
UniProt: Q13451
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
Target-Kategorie: FKBP5
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.
Brain, cortex.
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-FKBP5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.