EIF3I Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB326513
| Artikelname: |
EIF3I Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB326513 |
| Hersteller Artikelnummer: |
orb326513 |
| Alternativnummer: |
BYT-ORB326513-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, IP, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti EIF3S2 antibody, anti PRO2242 antibody, anti TRIP-1 antibody, anti TRIP1 antibody, anti eIF3-beta antibody, anti eIF3-p36 antibody |
| Rabbit polyclonal antibody to EIF3I |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
36kDa |
| NCBI: |
003748 |
| UniProt: |
Q13347 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPV |
| Target-Kategorie: |
EIF3I |
|
EIF3I antibody - C-terminal region (orb326513) validated by WB using HepG2 cell lysate at 1.0 ug/mL. |
|
Sample Type: Human 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane. |
|
Sample Type: Human 293T, Antibody Dilution: 1.0 ug/mL. |
|
Sample Type: 3. rat brain extract (80 ug), Primary antibody Dilution: 2 ug/mL, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody Dilution: 1:20000. |
|
Sample Type: Mouse brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: EIF3I: Red DAPI:Blue, Gene Name: EIF3I. |