Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW
Target-Kategorie:
CLUH
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 147 kDa isoform is identified.
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/mL.
KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb327010 with 1:200 dilution. Western blot was performed using orb327010 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: KIAA0664 IP with orb327010 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten