SIRT4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329660
- Bilder (6)
| Artikelname: | SIRT4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329660 |
| Hersteller Artikelnummer: | orb329660 |
| Alternativnummer: | BYT-ORB329660-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SIRT4 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti MGC130046 antibody, anti MGC130047 antibody, anti MGC57437 antibody, anti SIR2L4 antibody, anti sirtuin 4 antibody |
| Rabbit polyclonal antibody to SIRT4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 35kDa |
| NCBI: | 036372 |
| UniProt: | Q9Y6E7 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV |
| Target-Kategorie: | SIRT4 |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: MCF7, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12. |
|
|
Pancreas |
|
|
WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate. |
|
|
WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mL, Sample Type: Human Liver. |
|
|
WB Suggested Anti-SIRT4 antibody Titration: 1 ug/mL, Sample Type: Human Raji. |
Produktgarantie und fachkundiger Support
