AIRE Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329678
| Artikelname: |
AIRE Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB329678 |
| Hersteller Artikelnummer: |
orb329678 |
| Alternativnummer: |
BYT-ORB329678-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human AIRE |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti AIRE1 antibody, anti APECED antibody, anti APS1 antibody, anti APSI antibody, anti PGA1 antibody |
| Rabbit polyclonal antibody to AIRE |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
58kDa |
| NCBI: |
000374 |
| UniProt: |
O43918 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL |
| Target-Kategorie: |
AIRE |
|
AIRE antibody - N-terminal region (orb329678) validated by WB using human LCL at 1:1000. |
|
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
Rabbit Anti-AIRE Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
|
WB Suggested Anti-AIRE Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Liver. |