SOX5 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329718
- Bilder (6)
| Artikelname: | SOX5 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329718 |
| Hersteller Artikelnummer: | orb329718 |
| Alternativnummer: | BYT-ORB329718-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti L-SOX5 antibody, anti MGC35153 antibody |
| Rabbit polyclonal antibody to SOX5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 84 kDa |
| NCBI: | 821078 |
| UniProt: | P35711 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG |
| Target-Kategorie: | SOX5 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 84, 83, 82, 71, and 42 kDa. |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/mL, Peptide Concentration: 0.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
|
|
Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL. |
|
|
WB Suggested Anti-SOX5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. |
Produktgarantie und fachkundiger Support
