Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
Target-Kategorie:
PARP2
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The peptide is within isoform at 66 kDa, 65 kDa, and 58 kDa, also modified by phosphorylation.
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
WB Suggested Anti-PARP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Raji cell lysate, PARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
