G3BP1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB329937
Artikelname: G3BP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB329937
Hersteller Artikelnummer: orb329937
Alternativnummer: BYT-ORB329937-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1
Konjugation: Unconjugated
Alternative Synonym: anti G3BP antibody, anti HDH-VIII antibody, anti MGC111040 antibody
Rabbit polyclonal antibody to G3BP1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 005745
UniProt: Q13283
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
Target-Kategorie: G3BP1
Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: G3BP1, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: G3BP1.
IP Suggested Anti-G3BP1 Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.
Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: G3BP1.
Rabbit Anti-G3BP1 Antibody, Catalog Number: orb329937, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, G3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.