Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: PDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYV
Target-Kategorie:
ETV1
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Several isoforms contain this peptide sequence from 43 kDa to 57 kDa and the protein may be phosphorylated and/or sumoylated.
Sample Tissue: Human MDA-MB-435s, Antibody Dilution: 1.0 ug/mL.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5 ug/mL using anti-ETV1 antibody (orb329990).
WB Suggested Anti-ETV1 Antibody, Positive Control: Lane 1: 100 ug untransfected HEK293 lysate Lane 2: 33 ug ER81 transfected HEK293 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.
