Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC
Target-Kategorie:
TARDBP
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL. Two or more isoforms of this protein are known and at least two share the N-terminal peptide sequence.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. TARDBP is supported by BioGPS gene expression data to be expressed in HepG2.
Human kidney
Human Liver
WB Suggested Anti-TARDBP Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, TARDBP is supported by BioGPS gene expression data to be expressed in HepG2.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten