AARS Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB330122
Artikelname: AARS Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB330122
Hersteller Artikelnummer: orb330122
Alternativnummer: BYT-ORB330122-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AARS
Konjugation: Unconjugated
Alternative Synonym: anti CMT2N antibody
Rabbit polyclonal antibody to AARS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 107kDa
NCBI: 001596
UniProt: P49588
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT
Target-Kategorie: AARS
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, AARS is supported by BioGPS gene expression data to be expressed in Jurkat.
Rabbit Anti-AARS Antibody, Catalog Number: orb330122, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell processes of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
Rabbit Anti-AARS Antibody, Catalog Number: orb330122, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec, Protocol located in Reviews and Data.
Rabbit Anti-AARS antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-AARS Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, AARS is supported by BioGPS gene expression data to be expressed in Jurkat.