Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
Target-Kategorie:
COX4I1
COX4I1 antibody - N-terminal region (orb330257) validated by WB using 1. Human liver, 2. Rat liver, 3. Wild-type mouse liver, 4. AMPKa1+2-/- mouse liver, 5. Human muscle, 6. Rat muscle, 7. Mouse muscle at 1:1000.
COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330257 with 1:200 dilution. Western blot was performed using orb330257 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: COX4I1 IP with orb330257 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Human Heart
Human kidney
Lanes: Lane 1: 50 ug HeLa lysate, Lane 2: 50 ug 293T lysate, Lane 3: 50 ug K562 lysate, Lane 4: 50 ug MDA-MB-231 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: COX4I1.
WB Suggested Anti-COX4I1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, COX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten