FBXW2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330283
- Bilder (6)
| Artikelname: | FBXW2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330283 |
| Hersteller Artikelnummer: | orb330283 |
| Alternativnummer: | BYT-ORB330283-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human FBXW2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FBW2 antibody, anti Fwd2 antibody, anti MGC117371 antibody, anti Md6 antibody |
| Rabbit polyclonal antibody to FBXW2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 51kDa |
| NCBI: | 036296 |
| UniProt: | Q9UKT8 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI |
| Target-Kategorie: | FBXW2 |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Human Placenta (PL), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/mL. |
|
|
WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat. |
Produktgarantie und fachkundiger Support
