ARF1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330535
| Artikelname: |
ARF1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB330535 |
| Hersteller Artikelnummer: |
orb330535 |
| Alternativnummer: |
BYT-ORB330535-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, IP, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ARF1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PVNH8 |
| Rabbit polyclonal antibody to ARF1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
21kDa |
| NCBI: |
001649 |
| UniProt: |
P61204 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
| Target-Kategorie: |
ARF1 |
![]()
|
Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: ARF1, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: ARF1. |
![]()
|
ARF1 antibody - middle region (orb330535) validated by WB using Fetal lung Lysate at 0.2-1 ug/ml. |
![]()
|
Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000. |
![]()
|
Sample Type:Mouse Brain lysate. |
![]()
|
Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000. |
