SQSTM1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330733
- Bilder (7)
| Artikelname: | SQSTM1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330733 |
| Hersteller Artikelnummer: | orb330733 |
| Alternativnummer: | BYT-ORB330733-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SQSTM1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti A170 antibody, anti OSIL antibody, anti PDB3 antibody, anti ZIP3 antibody, anti p60 antibody, anti p62 antibody, anti p62B antibody |
| Rabbit polyclonal antibody to SQSTM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 48kDa |
| NCBI: | 003891 |
| UniProt: | Q13501 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE |
| Target-Kategorie: | SQSTM1 |
|
|
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Pancreas |
|
|
Rabbit Anti-SQSTM1 Antibody, Catalog Number: orb330733, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-SQSTM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Pancreas. |
Produktgarantie und fachkundiger Support
