Warenkorb

Produktsuche

Home
Produkte
HK2 Rabbit Polyclonal Antibody, Unconjugated

HK2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB330743

Bilder (5)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	HK2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:	BYT-ORB330743
Hersteller Artikelnummer:	orb330743
Alternativnummer:	BYT-ORB330743-100
Hersteller:	Biorbyt
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human
Immunogen:	The immunogen is a synthetic peptide directed towards the N terminal region of human HK2
Konjugation:	Unconjugated
Alternative Synonym:	anti DKFZp686M1669 antibody, anti HKII antibody, anti HXK2 antibody

Rabbit polyclonal antibody to HK2

Klonalität:	Polyclonal
Konzentration:	0.5 mg/ml
Molekulargewicht:	102kDa
NCBI:	000180
UniProt:	P52789
Puffer:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:	Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Target-Kategorie:	HK2

	Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Small Intestine (M-IN), Antibody concentration: 1 ug/ml.
	Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HK2 antibody (orb330743).
	Lanes: 1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: HK2.
	Rabbit Anti-HK2 Antibody, Catalog Number: orb330743, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
	WB Suggested Anti-HK2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, HK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten