ACADVL Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB330756
Artikelname: ACADVL Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB330756
Hersteller Artikelnummer: orb330756
Alternativnummer: BYT-ORB330756-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
Konjugation: Unconjugated
Alternative Synonym: anti ACAD6 antibody, anti LCACD antibody, anti VLCAD antibody
Rabbit polyclonal antibody to ACADVL
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 64kDa
NCBI: 001029031
UniProt: P49748
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Target-Kategorie: ACADVL
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ACADVL is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Lanes: 1: Normal controls Normal enzyme expression, 2: Normal controls Normal enzyme expression, 3: Positive mutants Defective enzyme expression, 4: Positive mutants Defective enzyme expression, 5: Positive mutants Defective enzyme expression, Primary Antibody dilution: 1:2000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: ACADVL.
Rabbit Anti-ACADVL Antibody, Catalog Number: orb330756, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, ACADVL is supported by BioGPS gene expression data to be expressed in HepG2.