GRN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330767
- Bilder (5)
| Artikelname: | GRN Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330767 |
| Hersteller Artikelnummer: | orb330767 |
| Alternativnummer: | BYT-ORB330767-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of Human GRN |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti GRN antibody, anti antibody |
| Rabbit polyclonal antibody to GRN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 64 kDa |
| UniProt: | P28799 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL |
| Target-Kategorie: | GRN |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 52 kDa is also present in some samples. |
|
|
50 ug of HEK293T WT and GRN KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/5000. The second image shows Ponceau S staining of the transferred blot as a loading control experiment. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml. |
|
|
Immunoprecipitation was performed on concentrated culture media from Brefeldin A treated HEK293T cells using 1.0 µg of the antibody pre-coupled to either protein G or protein A magnetic beads. Samples were washed and processed for immunoblot with an alternate GRN antibody at 1/1000. The Ponceau stained transfers of each blot are shown. SM=10% starting material, UB=10% unbound fraction, IP=immunoprecipitate. |
Produktgarantie und fachkundiger Support
