GSK3B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330768
- Bilder (7)
| Artikelname: | GSK3B Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330768 |
| Hersteller Artikelnummer: | orb330768 |
| Alternativnummer: | BYT-ORB330768-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B |
| Konjugation: | Unconjugated |
| Rabbit polyclonal antibody to GSK3B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 48kDa |
| NCBI: | 002084 |
| UniProt: | P49841 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF |
| Target-Kategorie: | GSK3B |
|
|
Brain, cortex. |
|
|
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. GSK3B is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Rabbit Anti-GSK3B Antibody, Catalog Number: orb330768, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Nucleus, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, GSK3B is supported by BioGPS gene expression data to be expressed in 721_B. |
Produktgarantie und fachkundiger Support
