LYN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330772
- Bilder (7)
| Artikelname: | LYN Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330772 |
| Hersteller Artikelnummer: | orb330772 |
| Alternativnummer: | BYT-ORB330772-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human LYN |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FLJ26625 antibody, anti JTK8 antibody, anti p53Lyn antibody, anti p56Lyn antibody |
| Rabbit polyclonal antibody to LYN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 58kDa |
| NCBI: | 002341 |
| UniProt: | P07948 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF |
| Target-Kategorie: | LYN |
|
|
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Rabbit Anti-LYN Antibody, Catalog Number: orb330772, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate, LYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells. |
Produktgarantie und fachkundiger Support
