IDH1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330780
- Bilder (6)
| Artikelname: | IDH1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330780 |
| Hersteller Artikelnummer: | orb330780 |
| Alternativnummer: | BYT-ORB330780-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti IDH antibody, anti IDP antibody, anti PICD antibody, anti IDCD antibody, anti IDPC antibody |
| Rabbit polyclonal antibody to IDH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 47kDa |
| NCBI: | 005887 |
| UniProt: | O75874 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ |
| Target-Kategorie: | IDH1 |
|
|
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2. |
|
|
Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml. |
|
|
Human Testis |
|
|
Human Testis |
|
|
WB Suggested Anti-IDH1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate. |
Produktgarantie und fachkundiger Support
